Awesome AI AgentsAI Agents

waooAI/waoowaoo

⭐ 14071 TypeScript added to this list on 2026-05-11 repository created 2026-01-22

WaooWaoo AI Studio is an innovative AI-powered tool for creating short dramas and animated videos. It streamlines the entire production process, automating tasks from novel text analysis to complete video generation. Key features include AI script analysis, which automatically extracts characters, scenes, and plot points from text. It also offers consistent AI-generated character and scene images, automated shot-by-shot video production, and multi-character AI voice synthesis. The platform supports multiple languages (Chinese/English) for interface use. The project emphasizes ease of use with Docker-based deployment options for quick setup, supporting pre-built images or local development. It provides clear instructions for installation, updates, and API key configuration for various AI services. The technical stack prominently features Next.js 15 with React 19 for the frontend, MySQL and Prisma ORM for data management, Redis and BullMQ for queuing, and Tailwind CSS v4 for styling. NextAuth.js handles authentication. The platform is designed for a complete, end-to-end AI-driven video production pipeline, aiming to be a leading AI tool in the industry.

https://github.com/waooAI/waoowaoo

ai-agentai-agentsautomationfilm-productiongenerative-aishort-dramastoryboardvideo-generationnextjsreactdockermysqlredisprismatailwindcssnextauth

Also in AI Agents

OpenHands/OpenHands

OpenHands is an AI-powered platform that automates software development tasks, enabling developers to code less and produce more by modifying code, running commands, browsing the web, and integrating APIs efficiently.

usestrix/strix

Strix is an open-source AI-driven security testing platform that autonomously finds, validates, and helps fix application vulnerabilities through dynamic and collaborative AI agents.

aaif-goose/goose

Goose is an open-source, native AI agent available as a desktop app, CLI, and API, designed for diverse tasks like code, research, writing, and automation, supporting over 15 LLM providers.

KeygraphHQ/shannon

Shannon is an autonomous AI pentester for web applications and APIs, analyzing source code, identifying attack vectors, and executing real exploits to prove vulnerabilities.

wshobson/agents

A comprehensive collection of 44 specialized AI subagents for Claude Code that enhance development workflows with domain-specific expertise across software development, infrastructure, security, data, and business domains.

agentscope-ai/agentscope

AgentScope is a transparent, modular, and customizable framework for building LLM-empowered multi-agent applications with real-time control and asynchronous execution.

iOfficeAI/OfficeCLI

OfficeCLI is an open-source command-line interface and API enabling AI agents to read, edit, and automate Word, Excel, and PowerPoint files without needing Office suite installations.

langchain-ai/deepagents

Deep Agents is an open-source agent harness built on LangChain and LangGraph that enables AI agents to plan, execute, and delegate complex long-horizon tasks using customizable tools, subagents, and human-in-the-loop workflows.